GHRH 1-44 -
GHRH 1-44 For Sale, Most Competitive Price, Fast Delivery, Custom Service, Wholesale GHRH 1-44, Made in China, High Quality Products!, China GHRH, GHRF Supplier, Manufacturer.Catalog#
F01-002-009
Sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Molecular Formula
C 215 H 358 N 72 O66 S
Molecular Weight
5039.76
Purity (HPLC)
95%
Description
A peptide of 44 amino acids in most species that stimulates the release and synthesis of GROWTH HORMONE. GHRF (or GRF) is synthesized by neurons in the ARCUATE NUCLEUS of the HYPOTHALAMUS. After being released into the pituitary portal circulation, GHRF stimulates GH release by the SOMATOTROPHS in the PITUITARY GLAND.
Shanghai QMBiosciences Co., Ltd.
Address: Suite 28-201, 2238 zhangyang, shanghai, Shanghai, China, 200135
Tel: 0086-21-68561878
Shanghai QMBiosciences Co., Ltd. is a manufacture and exporter of highly qualified peptides and proteins. We specialize in providing Bioactive Peptides,API Peptides, Cytokines, and Peptide Growth Factors for research uses, and we have long enjoyed an excellent reputation with our customers.
We have profound expertise in small- and large-scale solid phase peptides synthesis using both Boc- and Fmoc strategies as well as Recombinant Expression of Peptides and Proteins. With our experienced staff, we can offer high quality products and meet the demands from all our customers.